PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0917s0081.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 196aa    MW: 22151.5 Da    PI: 8.9712
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0917s0081.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF59.54.1e-19956148
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                         k ie ks rqvtfskRrng++ KA  LS+LC+  +av+++s +gkly 
  Cagra.0917s0081.1.p  9 KLIEKKSSRQVTFSKRRNGLIEKARQLSILCESSIAVLVVSGSGKLYN 56
                         569*******************************************97 PP

2K-box39.62.3e-141061634198
                K-box  41 edLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                          e +++ s+  L +Le+qLe++l+  R+kK+el++e ++ lq+ e+ l+een++L++++
  Cagra.0917s0081.1.p 106 EPVDNVSVDSLISLEEQLETALSVTRAKKTELMMEDVKSLQETERLLREENQYLTSQM 163
                          778999************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.83E-24173IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.31161IPR002100Transcription factor, MADS-box
SMARTSM004322.2E-28160IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-21323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003199.3E-201155IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-212338IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-213859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.41670169IPR002487Transcription factor, K-box
PfamPF014861.1E-10106162IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009910Biological Processnegative regulation of flower development
GO:0010221Biological Processnegative regulation of vernalization response
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MGRRKVEIKL IEKKSSRQVT FSKRRNGLIE KARQLSILCE SSIAVLVVSG SGKLYNSSSG  60
DNMAKIIDRY EIQHADELKV LDLAEKTRNY LPHKELLEMV QSKLEEPVDN VSVDSLISLE  120
EQLETALSVT RAKKTELMME DVKSLQETER LLREENQYLT SQMWKKTFLV TQGGRGISPE  180
NSSGNKVLET LPLLK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1412110.0AY141211.1 Arabidopsis thaliana MADS-box protein AGL31-II mRNA, complete cds.
GenBankAY2314410.0AY231441.1 Arabidopsis thaliana MADS affecting flowering 2 variant I (MAF2) mRNA, complete cds.
GenBankAY2314450.0AY231445.1 Arabidopsis thaliana MADS affecting flowering 3 variant I (MAF3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010462368.11e-121PREDICTED: agamous-like MADS-box protein AGL31 isoform X1
SwissprotQ9FPN71e-112AGL31_ARATH; Agamous-like MADS-box protein AGL31
TrEMBLC0J8N91e-111C0J8N9_ARATH; MAF3
STRINGAT5G65050.31e-109(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM9861987
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65050.31e-113AGAMOUS-like 31